PDK1 Kinase Enzyme System

Full-length rhPDK1 was expressed by baculovirus in Sf9 insect cells using an N-terminal His tag. PDK1 (3-phosphoinositide-dependent protein kinase) is activated by the presence of PtdIns(3,4,5)P3 or PtdIns(3,4)P2. PDK1 then activates protein kinase B (PKB), which in turn, inactivates glycogen synthase kinase-3 (GSK3). Phosphorylation of other proteins by PKB and GSK3 is likely to mediate many of the intracellular actions of insulin. Thus, PDK1 plays a key role in mediating many of the actions of the second messenger(s) PtdIns(3,4,5)P3 and PtdIns(3,4)P2. Human PDK1 has a catalytic domain that is most like the PKA, PKB and PKC subfamily of protein kinases. System contains: PDK1, 10ug (Human, recombinant full-length). MW: ~67kDa. Substrate: PDKtide (KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC); derived from two human proteins: residues 1-14 based on AKT1 (307-320) and residues 16-39 based on PKN2/PRK2 (961-984). Reaction Buffer: DTT. PDK1 NCBI Database Entry: www.ncbi.nlm.nih.gov/gene/5170/.